Lineage for d1jvab1 (1jva B:279-463,B:699-741)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678711Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 678712Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (2 families) (S)
    duplication: contains two intertwined structural repeats
  5. 678717Family b.86.1.2: Intein (protein splicing domain) [51298] (4 proteins)
  6. 678727Protein VMA1-derived endonuclease (VDE) PI-Scei intein [51299] (1 species)
    also contains a homing endonuclease and DNA-binding domains
  7. 678728Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51300] (8 PDB entries)
  8. 678731Domain d1jvab1: 1jva B:279-463,B:699-741 [77178]
    Other proteins in same PDB: d1jvaa2, d1jvaa3, d1jvab2, d1jvab3
    contains the N and C extein propeptides
    mutant

Details for d1jvab1

PDB Entry: 1jva (more details), 2.1 Å

PDB Description: crystal structure of the vma1-derived endonuclease bearing the n and c extein propeptides
PDB Compounds: (B:) vma1-derived homing endonuclease x10sss

SCOP Domain Sequences for d1jvab1:

Sequence, based on SEQRES records: (download)

>d1jvab1 b.86.1.2 (B:279-463,B:699-741) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iiyvgsfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksq
hrahksdssrevpellkftcnatnelvvrtprsvrrlsrtikgveyfevitfemgqkkap
dgrivelvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkat
yqtyaXcrgfyfelqelkeddyygitlsddsdhqfllanqvvvhssger

Sequence, based on observed residues (ATOM records): (download)

>d1jvab1 b.86.1.2 (B:279-463,B:699-741) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iiyvgsfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksp
ellkftcnatnelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgrivelvkevsk
sypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtyaXcrgfyfe
lqelkeddyygitlsddsdhqfllanqvvvhssger

SCOP Domain Coordinates for d1jvab1:

Click to download the PDB-style file with coordinates for d1jvab1.
(The format of our PDB-style files is described here.)

Timeline for d1jvab1: