Lineage for d1jvaa3 (1jva A:582-698)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260550Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 260556Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 260581Family d.95.2.2: Intein endonuclease [55614] (2 proteins)
    duplication: contains tandem repeat of this fold
  6. 260586Protein VMA1-derived endonuclease (VDE) PI-SceI [55615] (1 species)
    homing endonuclease with protein splicing activity
  7. 260587Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55616] (6 PDB entries)
  8. 260589Domain d1jvaa3: 1jva A:582-698 [77177]
    Other proteins in same PDB: d1jvaa1, d1jvab1

Details for d1jvaa3

PDB Entry: 1jva (more details), 2.1 Å

PDB Description: crystal structure of the vma1-derived endonuclease bearing the n and c extein propeptides

SCOP Domain Sequences for d1jvaa3:

Sequence, based on SEQRES records: (download)

>d1jvaa3 d.95.2.2 (A:582-698) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae)}
gvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslg
lvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafare

Sequence, based on observed residues (ATOM records): (download)

>d1jvaa3 d.95.2.2 (A:582-698) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae)}
gvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslg
lvvsvnaepkisyaiymsggdvllnvlskcagskkfrpapaaafare

SCOP Domain Coordinates for d1jvaa3:

Click to download the PDB-style file with coordinates for d1jvaa3.
(The format of our PDB-style files is described here.)

Timeline for d1jvaa3: