Lineage for d1jvaa2 (1jva A:464-581)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966038Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 2966049Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 2966143Family d.95.2.2: Intein endonuclease [55614] (2 proteins)
    duplication: contains tandem repeat of this fold
  6. 2966148Protein VMA1-derived endonuclease (VDE) PI-SceI [55615] (1 species)
    homing endonuclease with protein splicing activity
  7. 2966149Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55616] (7 PDB entries)
    Uniprot P17255 284-737
  8. 2966150Domain d1jvaa2: 1jva A:464-581 [77176]
    Other proteins in same PDB: d1jvaa1, d1jvab1

Details for d1jvaa2

PDB Entry: 1jva (more details), 2.1 Å

PDB Description: crystal structure of the vma1-derived endonuclease bearing the n and c extein propeptides
PDB Compounds: (A:) vma1-derived homing endonuclease x10sss

SCOPe Domain Sequences for d1jvaa2:

Sequence, based on SEQRES records: (download)

>d1jvaa2 d.95.2.2 (A:464-581) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkd

Sequence, based on observed residues (ATOM records): (download)

>d1jvaa2 d.95.2.2 (A:464-581) VMA1-derived endonuclease (VDE) PI-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
eyaeklnlcaeykdrkepqvaktvnlyskvenplwdaivglgflkd

SCOPe Domain Coordinates for d1jvaa2:

Click to download the PDB-style file with coordinates for d1jvaa2.
(The format of our PDB-style files is described here.)

Timeline for d1jvaa2: