SCOP 1.75: Domain d1ju5c_: 1ju5 C:

Lineage for d1ju5c_ (1ju5 C:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (39 proteins)

6. Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50054] (5 PDB entries)

8. Domain d1ju5c_: 1ju5 C: [77174]
   Other proteins in same PDB: d1ju5a_
   complexed with phs; mutant

Details for d1ju5c_

PDB Entry: 1ju5

PDB Description: ternary complex of an crk sh2 domain, crk-derived phophopeptide, and abl sh3 domain by nmr spectroscopy

PDB Compounds: (C:) Abl

SCOP Domain Sequences for d1ju5c_:

Sequence; same for both SEQRES and ATOM records:

>d1ju5c_ b.34.2.1 (C:) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
dpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

Timeline for d1ju5c_:

• d1ju5c_ first appeared in SCOP 1.63
  
• d1ju5c_ appears in SCOP 1.73
  
• d1ju5c_ appears in SCOPe 2.01
  
• d1ju5c_ appears in the current release, SCOPe 2.08