Lineage for d1ju2b2 (1ju2 B:294-463)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019250Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1019251Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1019252Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 1019286Protein Hydroxynitrile lyase [82588] (1 species)
  7. 1019287Species Almond (Prunus dulcis) [TaxId:3755] [82589] (1 PDB entry)
  8. 1019289Domain d1ju2b2: 1ju2 B:294-463 [77172]
    Other proteins in same PDB: d1ju2a1, d1ju2b1
    complexed with fad, ipa, nag

Details for d1ju2b2

PDB Entry: 1ju2 (more details), 1.47 Å

PDB Description: crystal structure of the hydroxynitrile lyase from almond
PDB Compounds: (B:) hydroxynitrile lyase

SCOPe Domain Sequences for d1ju2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ju2b2 d.16.1.1 (B:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]}
flhdnprnfinilppnpieptivtvlgisndfyqcsfsslpfttppfgffpsssyplpns
tfahfaskvagplsygsltlksssnvrvspnvkfnyysnltdlshcvsgmkkigellstd
alkpykvedlpgvegfnilgiplpkdqtddaafetfcresvasywhyhgg

SCOPe Domain Coordinates for d1ju2b2:

Click to download the PDB-style file with coordinates for d1ju2b2.
(The format of our PDB-style files is described here.)

Timeline for d1ju2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ju2b1