![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins) |
![]() | Protein Hydroxynitrile lyase [82588] (1 species) |
![]() | Species Almond (Prunus dulcis) [TaxId:3755] [82589] (1 PDB entry) |
![]() | Domain d1ju2b2: 1ju2 B:294-463 [77172] Other proteins in same PDB: d1ju2a1, d1ju2b1 complexed with fad, ipa, nag |
PDB Entry: 1ju2 (more details), 1.47 Å
SCOPe Domain Sequences for d1ju2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ju2b2 d.16.1.1 (B:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} flhdnprnfinilppnpieptivtvlgisndfyqcsfsslpfttppfgffpsssyplpns tfahfaskvagplsygsltlksssnvrvspnvkfnyysnltdlshcvsgmkkigellstd alkpykvedlpgvegfnilgiplpkdqtddaafetfcresvasywhyhgg
Timeline for d1ju2b2: