Lineage for d1ju2b2 (1ju2 B:294-463)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326096Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 326097Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 326098Family d.16.1.1: GMC oxidoreductases [54374] (4 proteins)
  6. 326123Protein Hydroxynitrile lyase [82588] (1 species)
  7. 326124Species Almond (Prunus dulcis) [TaxId:3755] [82589] (1 PDB entry)
  8. 326126Domain d1ju2b2: 1ju2 B:294-463 [77172]
    Other proteins in same PDB: d1ju2a1, d1ju2b1
    complexed with fad, fuc, ipa, man, nag

Details for d1ju2b2

PDB Entry: 1ju2 (more details), 1.47 Å

PDB Description: crystal structure of the hydroxynitrile lyase from almond

SCOP Domain Sequences for d1ju2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ju2b2 d.16.1.1 (B:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis)}
flhdnprnfinilppnpieptivtvlgisndfyqcsfsslpfttppfgffpsssyplpns
tfahfaskvagplsygsltlksssnvrvspnvkfnyysnltdlshcvsgmkkigellstd
alkpykvedlpgvegfnilgiplpkdqtddaafetfcresvasywhyhgg

SCOP Domain Coordinates for d1ju2b2:

Click to download the PDB-style file with coordinates for d1ju2b2.
(The format of our PDB-style files is described here.)

Timeline for d1ju2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ju2b1