Lineage for d1ju2b1 (1ju2 B:1-293,B:464-521)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 688694Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 688695Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) (S)
  5. 688749Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (15 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 688795Protein Hydroxynitrile lyase [82307] (1 species)
  7. 688796Species Almond (Prunus dulcis) [TaxId:3755] [82308] (1 PDB entry)
  8. 688798Domain d1ju2b1: 1ju2 B:1-293,B:464-521 [77171]
    Other proteins in same PDB: d1ju2a2, d1ju2b2
    complexed with fad, fuc, ipa, man, nag

Details for d1ju2b1

PDB Entry: 1ju2 (more details), 1.47 Å

PDB Description: crystal structure of the hydroxynitrile lyase from almond
PDB Compounds: (B:) hydroxynitrile lyase

SCOP Domain Sequences for d1ju2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ju2b1 c.3.1.2 (B:1-293,B:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]}
lattsdhdfsylsfaydatdlelegsydyvivgggtsgcplaatlsekykvlvlergslp
taypnvltadgfvynlqqeddgktpverfvsedgidnvrgrvlggtsiinagvyarants
iysasgvdwdmdlvnqtyewvedtivykpnsqswqsvtktafleagvhpnhgfsldheeg
tritgstfdnkgtrhaadellnkgnsnnlrvgvhasvekiifsnapgltatgviyrdsng
tphqafvrskgevivsagtigtpqllllsgvgpesylsslnipvvlshpyvgqXclvgkv
ldgdfrvtginalrvvdgstfpytpashpqgfylmlgryvgikilqersasd

SCOP Domain Coordinates for d1ju2b1:

Click to download the PDB-style file with coordinates for d1ju2b1.
(The format of our PDB-style files is described here.)

Timeline for d1ju2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ju2b2