SCOPe 2.01: Domain d1ju2a2: 1ju2 A:294-463

Lineage for d1ju2a2 (1ju2 A:294-463)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)

6. Protein Hydroxynitrile lyase [82588] (1 species)

7. Species Almond (Prunus dulcis) [TaxId:3755] [82589] (1 PDB entry)

8. Domain d1ju2a2: 1ju2 A:294-463 [77170]
   Other proteins in same PDB: d1ju2a1, d1ju2b1
   complexed with fad, ipa, nag

Details for d1ju2a2

PDB Entry: 1ju2, 1.47 Å

PDB Description: crystal structure of the hydroxynitrile lyase from almond

PDB Compounds: (A:) hydroxynitrile lyase

SCOPe Domain Sequences for d1ju2a2:

Sequence; same for both SEQRES and ATOM records:

>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]}
flhdnprnfinilppnpieptivtvlgisndfyqcsfsslpfttppfgffpsssyplpns
tfahfaskvagplsygsltlksssnvrvspnvkfnyysnltdlshcvsgmkkigellstd
alkpykvedlpgvegfnilgiplpkdqtddaafetfcresvasywhyhgg

Timeline for d1ju2a2:

• d1ju2a2 first appeared in SCOP 1.63
  
• d1ju2a2 appears in SCOP 1.75
  
• d1ju2a2 appears in SCOPe 2.02
  
• d1ju2a2 appears in the current release, SCOPe 2.08