Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Peroxisomal membrane protein Pex13p [82055] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82056] (3 PDB entries) |
Domain d1jqqd_: 1jqq D: [77167] |
PDB Entry: 1jqq (more details), 2.65 Å
SCOPe Domain Sequences for d1jqqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jqqd_ b.34.2.1 (D:) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sepidpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngni gyipynyieiikr
Timeline for d1jqqd_: