SCOPe 2.02: Domain d1jqqc_: 1jqq C:

Lineage for d1jqqc_ (1jqq C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Peroxisomal membrane protein Pex13p [82055] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82056] (3 PDB entries)

8. Domain d1jqqc_: 1jqq C: [77166]

Details for d1jqqc_

PDB Entry: 1jqq, 2.65 Å

PDB Description: Crystal structure of Pex13p(301-386) SH3 domain

PDB Compounds: (C:) peroxisomal membrane protein pas20

SCOPe Domain Sequences for d1jqqc_:

Sequence, based on SEQRES records:

>d1jqqc_ b.34.2.1 (C:) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sepidpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngni
gyipynyieiik

Sequence, based on observed residues (ATOM records):

>d1jqqc_ b.34.2.1 (C:) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sepidpsklefaralydfvpeemevalkkgdlmailskkdplgrdsdwwkvrtkngnigy
ipynyieiik

Timeline for d1jqqc_:

• d1jqqc_ first appeared in SCOP 1.63
  
• d1jqqc_ appears in SCOPe 2.01
  
• d1jqqc_ appears in SCOPe 2.03
  
• d1jqqc_ appears in the current release, SCOPe 2.08