![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein Peroxisomal membrane protein Pex13p [82055] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82056] (3 PDB entries) |
![]() | Domain d1jqqc_: 1jqq C: [77166] Other proteins in same PDB: d1jqqa2, d1jqqb2 |
PDB Entry: 1jqq (more details), 2.65 Å
SCOPe Domain Sequences for d1jqqc_:
Sequence, based on SEQRES records: (download)
>d1jqqc_ b.34.2.1 (C:) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sepidpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngni gyipynyieiik
>d1jqqc_ b.34.2.1 (C:) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sepidpsklefaralydfvpeemevalkkgdlmailskkdplgrdsdwwkvrtkngnigy ipynyieiik
Timeline for d1jqqc_: