Lineage for d1jqqb_ (1jqq B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120634Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1120893Protein Peroxisomal membrane protein Pex13p [82055] (1 species)
  7. 1120894Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82056] (3 PDB entries)
  8. 1120896Domain d1jqqb_: 1jqq B: [77165]

Details for d1jqqb_

PDB Entry: 1jqq (more details), 2.65 Å

PDB Description: Crystal structure of Pex13p(301-386) SH3 domain
PDB Compounds: (B:) peroxisomal membrane protein pas20

SCOPe Domain Sequences for d1jqqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqqb_ b.34.2.1 (B:) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isefgsepidpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrt
kngnigyipynyieiikrrkki

SCOPe Domain Coordinates for d1jqqb_:

Click to download the PDB-style file with coordinates for d1jqqb_.
(The format of our PDB-style files is described here.)

Timeline for d1jqqb_: