SCOPe 2.08: Domain d1jqqb1: 1jqq B:5-82

Lineage for d1jqqb1 (1jqq B:5-82)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Peroxisomal membrane protein Pex13p [82055] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82056] (3 PDB entries)

8. Domain d1jqqb1: 1jqq B:5-82 [77165]
   Other proteins in same PDB: d1jqqa2, d1jqqb2

Details for d1jqqb1

PDB Entry: 1jqq, 2.65 Å

PDB Description: Crystal structure of Pex13p(301-386) SH3 domain

PDB Compounds: (B:) peroxisomal membrane protein pas20

SCOPe Domain Sequences for d1jqqb1:

Sequence; same for both SEQRES and ATOM records:

>d1jqqb1 b.34.2.1 (B:5-82) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsepidpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngn
igyipynyieiikrrkki

Timeline for d1jqqb1:

• d1jqqb1 first appeared in SCOP 1.63, called d1jqqb_
  
• d1jqqb1 appears in SCOPe 2.07