Lineage for d1jqpa1 (1jqp A:1-118)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325092Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1325628Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families) (S)
    automatically mapped to Pfam PF08773
  5. 1325629Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein)
  6. 1325630Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species)
  7. 1325645Species Norway rat (Rattus norvegicus) [TaxId:10116] [82160] (1 PDB entry)
  8. 1325646Domain d1jqpa1: 1jqp A:1-118 [77162]
    Other proteins in same PDB: d1jqpa2
    complexed with cl, nag, so4

Details for d1jqpa1

PDB Entry: 1jqp (more details), 2.4 Å

PDB Description: dipeptidyl peptidase i (cathepsin c), a tetrameric cysteine protease of the papain family
PDB Compounds: (A:) dipeptidyl peptidase I

SCOPe Domain Sequences for d1jqpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqpa1 b.61.5.1 (A:1-118) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtpanctypdllgtwvfqvgprhprshincsvmepteekvvihlkkldtaydevgnsgyf
tliynqgfeivlndykwfaffkyevkgsraisychetmtgwvhdvlgrnwacfvgkkm

SCOPe Domain Coordinates for d1jqpa1:

Click to download the PDB-style file with coordinates for d1jqpa1.
(The format of our PDB-style files is described here.)

Timeline for d1jqpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jqpa2