Lineage for d1jqna_ (1jqn A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573147Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 573249Family c.1.12.3: Phosphoenolpyruvate carboxylase [51632] (1 protein)
  6. 573250Protein Phosphoenolpyruvate carboxylase [51633] (1 species)
    the common fold is decorated with many additional helices
  7. 573251Species Escherichia coli [TaxId:562] [51634] (4 PDB entries)
  8. 573252Domain d1jqna_: 1jqn A: [77159]
    complexed with asp, dco, mn

Details for d1jqna_

PDB Entry: 1jqn (more details), 2.35 Å

PDB Description: crystal structure of e.coli phosphoenolpyruvate carboxylase in complex with mn2+ and dcdp

SCOP Domain Sequences for d1jqna_:

Sequence, based on SEQRES records: (download)

>d1jqna_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia coli}
qysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttlqnl
sndellpvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsedtik
kaveslslelvltahpteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrqlia
qswhtdeirklrpspvdeakwgfavvenslwqgvpnylrelneqleenlgyklpvefvpv
rftswmggdrdgnpnvtaditrhvlllsrwkatdlflkdiqvlvselsmveatpellalv
geegaaepyrylmknlrsrlmatqawlearlkgeelpkpeglltqneelweplyacyqsl
qacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylgigdyeswse
adkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktpsdv
lavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmigysd
sakdagvmaaswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqppgs
lkgglrvteqgemirfkyglpeitvsslslytgaileanllpppepkeswrrimdelsvi
scdvyrgyvrenkdfvpyfrsatpeqelgklplgsrpakrrptggveslraipwifawtq
nrlmlpawlgagtalqkvvedgkqseleamcrdwpffstrlgmlemvfakadlwlaeyyd
qrlvdkalwplgkelrnlqeedikvvlaiandshlmadlpwiaesiqlrniytdplnvlq
aellhrsrqaekegqepdprveqalmvtiagiaagmrntg

Sequence, based on observed residues (ATOM records): (download)

>d1jqna_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia coli}
qysalrsnvsmlgkvlgetikdalgehilervetirklskssragndanrqellttlqnl
sndellpvarafsqflnlantaeqyhsispkgeaasnpeviartlrklknqpelsedtik
kaveslslelvltahpteitrrtlihkmvevnaclkqldnkdiadyehnqlmrrlrqlia
qswhtdeirklrpspvdeakwgfavvenslwqgvpnylrelneqleenlgyklpvefvpv
rftswmggdrdgnpnvtaditrhvlllsrwkatdlflkdiqvlvselsmveatpellalv
geegaaepyrylmknlrsrlmatqawlearlkgeelpkpeglltqneelweplyacyqsl
qacgmgiiangdlldtlrrvkcfgvplvridirqestrhtealgeltrylgigdyeswse
adkqaflirelnskrpllprnwqpsaetrevldtcqviaeapqgsiaayvismaktpsdv
lavhlllkeagigfampvaplfetlddlnnandvmtqllnidwyrgliqgkqmvmigysd
sakdagvmaaswaqyqaqdaliktcekagieltlfhgrggsigrggapahaallsqppgs
lkgglrvteqgemirfkyglpeitvsslslytgaileanllpppepkeswrrimdelsvi
scdvyrgyvrenkdfvpyfrsatpeqelgklplgsrpggveslraipwifawtqnrlmlp
awlgagtalqkvvedgkqseleamcrdwpffstrlgmlemvfakadlwlaeyydqrlvdk
alwplgkelrnlqeedikvvlaiandshlmadlpwiaesiqlrniytdplnvlqaellhr
srqaekegqepdprveqalmvtiagiaagmrntg

SCOP Domain Coordinates for d1jqna_:

Click to download the PDB-style file with coordinates for d1jqna_.
(The format of our PDB-style files is described here.)

Timeline for d1jqna_: