Lineage for d1jqbc1 (1jqb C:3001-3139,C:3314-3351)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558338Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 558339Species Clostridium beijerinckii [50143] (3 PDB entries)
  8. 558342Domain d1jqbc1: 1jqb C:3001-3139,C:3314-3351 [77155]
    Other proteins in same PDB: d1jqba2, d1jqbb2, d1jqbc2, d1jqbd2

Details for d1jqbc1

PDB Entry: 1jqb (more details), 1.97 Å

PDB Description: alcohol dehydrogenase from clostridium beijerinckii: crystal structure of mutant with enhanced thermal stability

SCOP Domain Sequences for d1jqbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqbc1 b.35.1.2 (C:3001-3139,C:3314-3351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdXvdlsklvthvyhgfdhieealllmkdkpkdlikavvil

SCOP Domain Coordinates for d1jqbc1:

Click to download the PDB-style file with coordinates for d1jqbc1.
(The format of our PDB-style files is described here.)

Timeline for d1jqbc1: