Lineage for d1jq9a_ (1jq9 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217995Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulphide-linked, and a calcium-binding loop
  4. 217996Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 218001Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 218072Protein Snake phospholipase A2 [48624] (19 species)
  7. 218147Species Snake (Daboia russelli pulchella) [48630] (6 PDB entries)
  8. 218150Domain d1jq9a_: 1jq9 A: [77149]

Details for d1jq9a_

PDB Entry: 1jq9 (more details), 1.8 Å

PDB Description: crystal structure of a complex formed between phospholipase a2 from daboia russelli pulchella and a designed pentapeptide phe-leu-ser- tyr-lys at 1.8 resolution

SCOP Domain Sequences for d1jq9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jq9a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d1jq9a_:

Click to download the PDB-style file with coordinates for d1jq9a_.
(The format of our PDB-style files is described here.)

Timeline for d1jq9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jq9b_