| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
| Protein Snake phospholipase A2 [48624] (35 species) |
| Species Snake (Daboia russelli pulchella) [48630] (26 PDB entries) |
| Domain d1jq8b_: 1jq8 B: [77148] complexed with a designed peptide inhibitor, chain P |
PDB Entry: 1jq8 (more details), 2 Å
SCOP Domain Sequences for d1jq8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jq8b_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c
Timeline for d1jq8b_: