Lineage for d1jq8b_ (1jq8 B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217995Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulphide-linked, and a calcium-binding loop
  4. 217996Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 218001Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 protein domains)
  6. 218072Protein Snake phospholipase A2 [48624] (19 species)
  7. 218147Species Snake (Daboia russelli pulchella) [48630] (6 PDB entries)
  8. 218155Domain d1jq8b_: 1jq8 B: [77148]
    complexed with a designed peptide inhibitor, chain P
    complexed with acy, so4

Details for d1jq8b_

PDB Entry: 1jq8 (more details), 2 Å

PDB Description: design of specific inhibitors of phospholipase a2: crystal structure of a complex formed between phospholipase a2 from daboia russelli pulchella and a designed pentapeptide leu-ala-ile-tyr-ser at 2.0 resolution

SCOP Domain Sequences for d1jq8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jq8b_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d1jq8b_:

Click to download the PDB-style file with coordinates for d1jq8b_.
(The format of our PDB-style files is described here.)

Timeline for d1jq8b_: