SCOPe 2.07: Domain d1jq8a_: 1jq8 A:

Lineage for d1jq8a_ (1jq8 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
   Uniprot P59071

8. Domain d1jq8a_: 1jq8 A: [77147]
   complexed with a designed peptide inhibitor, chain P
   complexed with acy, so4

Details for d1jq8a_

PDB Entry: 1jq8, 2 Å

PDB Description: design of specific inhibitors of phospholipase a2: crystal structure of a complex formed between phospholipase a2 from daboia russelli pulchella and a designed pentapeptide leu-ala-ile-tyr-ser at 2.0 resolution

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1jq8a_:

Sequence; same for both SEQRES and ATOM records:

>d1jq8a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1jq8a_:

• d1jq8a_ first appeared in SCOP 1.63
  
• d1jq8a_ appears in SCOPe 2.06
  
• d1jq8a_ appears in the current release, SCOPe 2.08