Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain [74863] (1 family) |
Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain [74864] (1 protein) |
Protein Thiol:disulfide interchange protein DsbD, N-terminal domain [74865] (1 species) |
Species Escherichia coli [TaxId:562] [74866] (2 PDB entries) |
Domain d1jpea_: 1jpe A: [77146] |
PDB Entry: 1jpe (more details), 1.9 Å
SCOP Domain Sequences for d1jpea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpea_ b.1.17.1 (A:) Thiol:disulfide interchange protein DsbD, N-terminal domain {Escherichia coli} qfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhede fygkseiyrdrltlpvtinqasagatltvtyqgcadagfcyppetktvplsevvan
Timeline for d1jpea_: