Lineage for d1jpea_ (1jpe A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223256Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain [74863] (1 family) (S)
  5. 223257Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain [74864] (1 protein)
  6. 223258Protein Thiol:disulfide interchange protein DsbD, N-terminal domain [74865] (1 species)
  7. 223259Species Escherichia coli [TaxId:562] [74866] (2 PDB entries)
  8. 223261Domain d1jpea_: 1jpe A: [77146]

Details for d1jpea_

PDB Entry: 1jpe (more details), 1.9 Å

PDB Description: Crystal structure of DsbD-alpha; the N-terminal domain of DsbD

SCOP Domain Sequences for d1jpea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpea_ b.1.17.1 (A:) Thiol:disulfide interchange protein DsbD, N-terminal domain {Escherichia coli}
qfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhede
fygkseiyrdrltlpvtinqasagatltvtyqgcadagfcyppetktvplsevvan

SCOP Domain Coordinates for d1jpea_:

Click to download the PDB-style file with coordinates for d1jpea_.
(The format of our PDB-style files is described here.)

Timeline for d1jpea_: