Lineage for d1jpea_ (1jpe A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032092Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families) (S)
  5. 2032093Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 protein domains)
  6. 2032094Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species)
  7. 2032095Species Escherichia coli [TaxId:562] [74866] (6 PDB entries)
  8. 2032097Domain d1jpea_: 1jpe A: [77146]

Details for d1jpea_

PDB Entry: 1jpe (more details), 1.9 Å

PDB Description: Crystal structure of DsbD-alpha; the N-terminal domain of DsbD
PDB Compounds: (A:) DsbD-alpha

SCOPe Domain Sequences for d1jpea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpea_ b.1.17.1 (A:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli [TaxId: 562]}
qfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhede
fygkseiyrdrltlpvtinqasagatltvtyqgcadagfcyppetktvplsevvan

SCOPe Domain Coordinates for d1jpea_:

Click to download the PDB-style file with coordinates for d1jpea_.
(The format of our PDB-style files is described here.)

Timeline for d1jpea_: