Lineage for d1jogd_ (1jog D:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279291Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 279576Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (3 families) (S)
  5. 279584Family a.24.16.2: Family 1 bi-partite nucleotidyltransferase subunit [81740] (1 protein)
  6. 279585Protein Hypotetical protein HI0074 [81741] (1 species)
    function unknown; form complex with putative catalytic subunit HI0073
  7. 279586Species Haemophilus influenzae [TaxId:727] [81742] (1 PDB entry)
  8. 279590Domain d1jogd_: 1jog D: [77145]
    structural genomics
    complexed with mse

Details for d1jogd_

PDB Entry: 1jog (more details), 2.4 Å

PDB Description: Structure of HI0074 from Heamophilus Influenzae reveals the fold of a substrate binding domain of a nucleotidyltransferase

SCOP Domain Sequences for d1jogd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jogd_ a.24.16.2 (D:) Hypotetical protein HI0074 {Haemophilus influenzae}
nlnvldaafysleqtvvqisdrnwfdmqpsivqdtliagaiqkfefvyelslkmmkrqlq
qdaintddigaygfkdilrealrfgligdmskwvayrdmrnitshtydqekamavyaqid
dfliessflleqlrqr

SCOP Domain Coordinates for d1jogd_:

Click to download the PDB-style file with coordinates for d1jogd_.
(The format of our PDB-style files is described here.)

Timeline for d1jogd_: