Class a: All alpha proteins [46456] (286 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) |
Family a.24.16.2: Family 1 bi-partite nucleotidyltransferase subunit [81740] (2 proteins) automatically mapped to Pfam PF08780 |
Protein Hypothetical protein HI0074 [81741] (1 species) function unknown; form complex with putative catalytic subunit HI0073 (see 1no5) |
Species Haemophilus influenzae [TaxId:727] [81742] (1 PDB entry) |
Domain d1jogb_: 1jog B: [77143] structural genomics |
PDB Entry: 1jog (more details), 2.4 Å
SCOPe Domain Sequences for d1jogb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jogb_ a.24.16.2 (B:) Hypothetical protein HI0074 {Haemophilus influenzae [TaxId: 727]} nlnvldaafysleqtvvqisdrnwfdmqpsivqdtliagaiqkfefvyelslkmmkrqlq qdaintddigaygfkdilrealrfgligdmskwvayrdmrnitshtydqekamavyaqid dfliessflleqlrq
Timeline for d1jogb_: