SCOPe 2.05: Domain d1jogb_: 1jog B:

Lineage for d1jogb_ (1jog B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families)

5. Family a.24.16.2: Family 1 bi-partite nucleotidyltransferase subunit [81740] (2 proteins)
   automatically mapped to Pfam PF08780

6. Protein Hypothetical protein HI0074 [81741] (1 species)
   function unknown; form complex with putative catalytic subunit HI0073 (see 1no5)

7. Species Haemophilus influenzae [TaxId:727] [81742] (1 PDB entry)

8. Domain d1jogb_: 1jog B: [77143]
   structural genomics

Details for d1jogb_

PDB Entry: 1jog, 2.4 Å

PDB Description: Structure of HI0074 from Heamophilus Influenzae reveals the fold of a substrate binding domain of a nucleotidyltransferase

PDB Compounds: (B:) hypothetical protein hi0074

SCOPe Domain Sequences for d1jogb_:

Sequence; same for both SEQRES and ATOM records:

>d1jogb_ a.24.16.2 (B:) Hypothetical protein HI0074 {Haemophilus influenzae [TaxId: 727]}
nlnvldaafysleqtvvqisdrnwfdmqpsivqdtliagaiqkfefvyelslkmmkrqlq
qdaintddigaygfkdilrealrfgligdmskwvayrdmrnitshtydqekamavyaqid
dfliessflleqlrq

Timeline for d1jogb_:

• d1jogb_ first appeared in SCOP 1.63
  
• d1jogb_ appears in SCOPe 2.04
  
• d1jogb_ appears in SCOPe 2.06
  
• d1jogb_ appears in the current release, SCOPe 2.08