Lineage for d1joga_ (1jog A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211870Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 212150Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (2 families) (S)
  5. 212158Family a.24.16.2: Bi-partite nucleotidyltransferase subunit [81740] (1 protein)
  6. 212159Protein Hypotetical protein HI0074 [81741] (1 species)
    function unknown; form complex with putative catalytic subunit HI0073
  7. 212160Species Haemophilus influenzae [TaxId:727] [81742] (1 PDB entry)
  8. 212161Domain d1joga_: 1jog A: [77142]

Details for d1joga_

PDB Entry: 1jog (more details), 2.4 Å

PDB Description: Structure of HI0074 from Heamophilus Influenzae reveals the fold of a substrate binding domain of a nucleotidyltransferase

SCOP Domain Sequences for d1joga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1joga_ a.24.16.2 (A:) Hypotetical protein HI0074 {Haemophilus influenzae}
nlnvldaafysleqtvvqisdrnwfdmqpsivqdtliagaiqkfefvyelslkmmkrqlq
qdaintddigaygfkdilrealrfgligdmskwvayrdmrnitshtydqekamavyaqid
dfliessflleqlrq

SCOP Domain Coordinates for d1joga_:

Click to download the PDB-style file with coordinates for d1joga_.
(The format of our PDB-style files is described here.)

Timeline for d1joga_: