SCOPe 2.07: Domain d1jn7a1: 1jn7 A:3-36

Lineage for d1jn7a1 (1jn7 A:3-36)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.2: C2HC finger [57697] (3 proteins)

6. Protein U-shaped transcription factor, different fingers [57698] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57699] (4 PDB entries)

8. Domain d1jn7a1: 1jn7 A:3-36 [77139]
   Other proteins in same PDB: d1jn7a2
   CCHH mutant of the ninth zinc-finger domain
   complexed with zn; mutant

Details for d1jn7a1

PDB Entry: 1jn7

PDB Description: solution structure of a cchh mutant of the ninth cchc zinc finger of u-shaped

PDB Compounds: (A:) u-shaped transcriptional cofactor

SCOPe Domain Sequences for d1jn7a1:

Sequence; same for both SEQRES and ATOM records:

>d1jn7a1 g.37.1.2 (A:3-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aaevmkkycstcdisfnyvktylahkqfyhknkp

Timeline for d1jn7a1:

• d1jn7a1 first appeared in SCOP 1.63, called d1jn7a_
  
• d1jn7a1 appears in SCOPe 2.06
  
• d1jn7a1 appears in the current release, SCOPe 2.08