Lineage for d1jn7a1 (1jn7 A:3-36)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261821Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 2261822Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 2262142Family g.37.1.2: C2HC finger [57697] (3 proteins)
  6. 2262150Protein U-shaped transcription factor, different fingers [57698] (1 species)
  7. 2262151Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57699] (4 PDB entries)
  8. 2262155Domain d1jn7a1: 1jn7 A:3-36 [77139]
    Other proteins in same PDB: d1jn7a2
    CCHH mutant of the ninth zinc-finger domain
    complexed with zn; mutant

Details for d1jn7a1

PDB Entry: 1jn7 (more details)

PDB Description: Solution Structure of a CCHH mutant of the ninth CCHC Zinc Finger of U-shaped
PDB Compounds: (A:) u-shaped transcriptional cofactor

SCOPe Domain Sequences for d1jn7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jn7a1 g.37.1.2 (A:3-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aaevmkkycstcdisfnyvktylahkqfyhknkp

SCOPe Domain Coordinates for d1jn7a1:

Click to download the PDB-style file with coordinates for d1jn7a1.
(The format of our PDB-style files is described here.)

Timeline for d1jn7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jn7a2