Lineage for d1jmo.1 (1jmo L:,H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1546204Protein Thrombin [50531] (2 species)
  7. 1546240Species Human (Homo sapiens) [TaxId:9606] [50532] (169 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 1546433Domain d1jmo.1: 1jmo L:,H: [77137]
    Other proteins in same PDB: d1jmoa_
    complex with a heparin cofactor II mutant
    complexed with mpd, na, nag, ndg

Details for d1jmo.1

PDB Entry: 1jmo (more details), 2.2 Å

PDB Description: crystal structure of the heparin cofactor ii-s195a thrombin complex
PDB Compounds: (H:) Thrombin, heavy chain, (L:) Thrombin, light chain

SCOPe Domain Sequences for d1jmo.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1jmo.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
atseyqtffnprtfgsgeadcglrplfekksledkterellesyidgXivegsdaeigms
pwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtrye
rniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqa
gykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykp
degkrgdacegdaggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqk
vidqfge

SCOPe Domain Coordinates for d1jmo.1:

Click to download the PDB-style file with coordinates for d1jmo.1.
(The format of our PDB-style files is described here.)

Timeline for d1jmo.1: