Lineage for d1jmjb_ (1jmj B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012400Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 3012401Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 3012402Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 3012490Protein Heparin cofactor II (Hc-II, leuserpin 2) [82833] (1 species)
  7. 3012491Species Human (Homo sapiens) [TaxId:9606] [82834] (2 PDB entries)
  8. 3012493Domain d1jmjb_: 1jmj B: [77136]
    complexed with ca, nag

Details for d1jmjb_

PDB Entry: 1jmj (more details), 2.35 Å

PDB Description: crystal structure of native heparin cofactor ii
PDB Compounds: (B:) heparin cofactor II

SCOPe Domain Sequences for d1jmjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmjb_ e.1.1.1 (B:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]}
ilqlfhgksriqrlnilnakfafnlyrvlkdqvntfdnifiapvgistamgmislglkge
theqvhsilhfkdfvnasskyeittihnlfrklthrlfrrnfgytlrsvndlyiqkqfpi
lldfktkvreyyfaeaqiadfsdpafisktnnhimkltkglikdalenidpatqmmilnc
iyfkgswvnkfpvemthnhnfrlnerevvkvsmmqtkgnflaandqeldcdilqleyvgg
ismlivvphkmsgmktleaqltprvverwqksmtnrtrevllpkfkleknynlveslklm
girmlfdkngnmagisdqriaidlfkhqgtitvneegtqattvttvgfmplstqvrftvd
rpflfliyehrtscllfmgrvanpsrs

SCOPe Domain Coordinates for d1jmjb_:

Click to download the PDB-style file with coordinates for d1jmjb_.
(The format of our PDB-style files is described here.)

Timeline for d1jmjb_: