Lineage for d1ji4e_ (1ji4 E:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766238Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 766379Species Helicobacter pylori, Nap [TaxId:210] [81743] (1 PDB entry)
  8. 766384Domain d1ji4e_: 1ji4 E: [77121]

Details for d1ji4e_

PDB Entry: 1ji4 (more details), 2.52 Å

PDB Description: NAP protein from helicobacter pylori
PDB Compounds: (E:) neutrophil-activating protein a

SCOP Domain Sequences for d1ji4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji4e_ a.25.1.1 (E:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]}
mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
tvtyaddqlaklqksiwmlqahla

SCOP Domain Coordinates for d1ji4e_:

Click to download the PDB-style file with coordinates for d1ji4e_.
(The format of our PDB-style files is described here.)

Timeline for d1ji4e_: