Lineage for d1ji4b_ (1ji4 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264537Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1264678Species Helicobacter pylori, Nap [TaxId:210] [81743] (7 PDB entries)
  8. 1264685Domain d1ji4b_: 1ji4 B: [77118]
    complexed with fe, mpd, unx

Details for d1ji4b_

PDB Entry: 1ji4 (more details), 2.52 Å

PDB Description: NAP protein from helicobacter pylori
PDB Compounds: (B:) neutrophil-activating protein a

SCOPe Domain Sequences for d1ji4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji4b_ a.25.1.1 (B:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]}
mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
tvtyaddqlaklqksiwmlqahla

SCOPe Domain Coordinates for d1ji4b_:

Click to download the PDB-style file with coordinates for d1ji4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ji4b_: