Lineage for d1je8e_ (1je8 E:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210981Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 210997Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (3 proteins)
    contains additional, fourth helix in the C-terminal extension
  6. 211006Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species)
  7. 211007Species Escherichia coli [TaxId:562] [46902] (3 PDB entries)
  8. 211012Domain d1je8e_: 1je8 E: [77110]

Details for d1je8e_

PDB Entry: 1je8 (more details), 2.12 Å

PDB Description: Two-Component response regulator NarL/DNA Complex: DNA Bending Found in a High Affinity Site

SCOP Domain Sequences for d1je8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1je8e_ a.4.6.2 (E:) Nitrate/nitrite response regulator (NarL) {Escherichia coli}
erdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavw
vhqerif

SCOP Domain Coordinates for d1je8e_:

Click to download the PDB-style file with coordinates for d1je8e_.
(The format of our PDB-style files is described here.)

Timeline for d1je8e_: