SCOP 1.63: Domain d1je8e_: 1je8 E:

Lineage for d1je8e_ (1je8 E:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (3 proteins)
   contains additional, fourth helix in the C-terminal extension

6. Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species)

7. Species Escherichia coli [TaxId:562] [46902] (3 PDB entries)

8. Domain d1je8e_: 1je8 E: [77110]

Details for d1je8e_

PDB Entry: 1je8, 2.12 Å

PDB Description: Two-Component response regulator NarL/DNA Complex: DNA Bending Found in a High Affinity Site

SCOP Domain Sequences for d1je8e_:

Sequence; same for both SEQRES and ATOM records:

>d1je8e_ a.4.6.2 (E:) Nitrate/nitrite response regulator (NarL) {Escherichia coli}
erdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavw
vhqerif

Timeline for d1je8e_:

• d1je8e_ is new in SCOP 1.63
  
• d1je8e_ appears in SCOP 1.65
  
• d1je8e_ appears in the current release, SCOPe 2.08