| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
| Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins) contains additional, fourth helix in the C-terminal extension |
| Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species) |
| Species Escherichia coli [TaxId:562] [46902] (5 PDB entries) |
| Domain d1je8a_: 1je8 A: [77108] C-domain only protein/DNA complex; complexed with so4 |
PDB Entry: 1je8 (more details), 2.12 Å
SCOPe Domain Sequences for d1je8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1je8a_ a.4.6.2 (A:) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]}
rdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwv
hqerif
Timeline for d1je8a_: