Lineage for d1jd9a2 (1jd9 A:1-354)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815286Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 815397Protein Bacterial alpha-amylase [51447] (10 species)
  7. 815435Species Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId:228] [51449] (9 PDB entries)
  8. 815444Domain d1jd9a2: 1jd9 A:1-354 [77107]
    Other proteins in same PDB: d1jd9a1
    complexed with ca; mutant

Details for d1jd9a2

PDB Entry: 1jd9 (more details), 2.5 Å

PDB Description: crystal structure analysis of the mutant k300q of pseudoalteromonas haloplanctis alpha-amylase
PDB Compounds: (A:) alpha-amylase

SCOP Domain Sequences for d1jd9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jd9a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]}
tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypq
vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntad

SCOP Domain Coordinates for d1jd9a2:

Click to download the PDB-style file with coordinates for d1jd9a2.
(The format of our PDB-style files is described here.)

Timeline for d1jd9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jd9a1