Lineage for d1jd7a1 (1jd7 A:355-448)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808141Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 808142Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 808143Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 808243Protein Bacterial alpha-Amylase [51013] (9 species)
  7. 808280Species Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId:228] [51015] (9 PDB entries)
  8. 808287Domain d1jd7a1: 1jd7 A:355-448 [77104]
    Other proteins in same PDB: d1jd7a2
    complexed with ca, cl; mutant

Details for d1jd7a1

PDB Entry: 1jd7 (more details), 2.25 Å

PDB Description: crystal structure analysis of the mutant k300r of pseudoalteromonas haloplanctis alpha-amylase
PDB Compounds: (A:) alpha-amylase

SCOP Domain Sequences for d1jd7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jd7a1 b.71.1.1 (A:355-448) Bacterial alpha-Amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln

SCOP Domain Coordinates for d1jd7a1:

Click to download the PDB-style file with coordinates for d1jd7a1.
(The format of our PDB-style files is described here.)

Timeline for d1jd7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jd7a2