SCOP 1.71: Domain d1jd7a1: 1jd7 A:355-448

Lineage for d1jd7a1 (1jd7 A:355-448)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (7 species)

7. Species Pseudoalteromonas haloplanctis (Alteromonas haloplanctis) [51015] (9 PDB entries)

8. Domain d1jd7a1: 1jd7 A:355-448 [77104]
   Other proteins in same PDB: d1jd7a2
   complexed with ca, cl; mutant

Details for d1jd7a1

PDB Entry: 1jd7, 2.25 Å

PDB Description: crystal structure analysis of the mutant k300r of pseudoalteromonas haloplanctis alpha-amylase

SCOP Domain Sequences for d1jd7a1:

Sequence; same for both SEQRES and ATOM records:

>d1jd7a1 b.71.1.1 (A:355-448) Bacterial alpha-Amylase {Pseudoalteromonas haloplanctis (Alteromonas haloplanctis)}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln

Timeline for d1jd7a1:

• d1jd7a1 first appeared in SCOP 1.63
  
• d1jd7a1 appears in SCOP 1.69
  
• d1jd7a1 appears in SCOP 1.73
  
• d1jd7a1 appears in the current release, SCOPe 2.08