| Class b: All beta proteins [48724] (149 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Bacterial alpha-Amylase [51013] (7 species) |
| Species Pseudoalteromonas haloplanctis (Alteromonas haloplanctis) [51015] (9 PDB entries) |
| Domain d1jd7a1: 1jd7 A:355-448 [77104] Other proteins in same PDB: d1jd7a2 complexed with ca, cl; mutant |
PDB Entry: 1jd7 (more details), 2.25 Å
SCOP Domain Sequences for d1jd7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jd7a1 b.71.1.1 (A:355-448) Bacterial alpha-Amylase {Pseudoalteromonas haloplanctis (Alteromonas haloplanctis)}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln
Timeline for d1jd7a1: