Lineage for d1jd7a1 (1jd7 A:355-448)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Bacterial alpha-Amylase [51013] (4 species) 
Species Pseudoalteromonas haloplanctis (Alteromonas haloplanctis) [51015] (9 PDB entries) 
Domain d1jd7a1: 1jd7 A:355-448 [77104]
Other proteins in same PDB: d1jd7a2
complexed with ca, cl; mutant
Details for d1jd7a1
PDB Entry: 1jd7 (more details), 2.25 Å
PDB Description: crystal structure analysis of the mutant k300r of pseudoalteromonas haloplanctis alpha-amylase
SCOP Domain Sequences for d1jd7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jd7a1 b.71.1.1 (A:355-448) Bacterial alpha-Amylase {Pseudoalteromonas haloplanctis (Alteromonas haloplanctis)}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln
SCOP Domain Coordinates for d1jd7a1:
Click to download the PDB-style file with coordinates for d1jd7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jd7a1:
- d1jd7a1 is new in SCOP 1.63
- d1jd7a1 appears in SCOP 1.65
- d1jd7a1 appears in the current release, SCOPe 2.08
View in 3D
