Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (5 proteins) contains extra strand (3) in the parallel beta-sheet, order 321546 |
Protein Hypothetical tRNA/rRNA methyltransfease HI0766 (YibK homologue) [82374] (1 species) |
Species Haemophilus influenzae [TaxId:727] [82375] (2 PDB entries) |
Domain d1j85a_: 1j85 A: [77100] |
PDB Entry: 1j85 (more details), 2 Å
SCOPe Domain Sequences for d1j85a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j85a_ c.116.1.1 (A:) Hypothetical tRNA/rRNA methyltransfease HI0766 (YibK homologue) {Haemophilus influenzae [TaxId: 727]} mldivlyepeipqntgniirlcantgfrlhlieplgftwddkrlrrsgldyhefaeikrh ktfeaflesekpkrlfalttkgcpahsqvkfklgdylmfgpetrgipmsilnempmeqki ripmtansrsmnlsnsvavtvyeawrqlgykgavnl
Timeline for d1j85a_: