Lineage for d1j6ua1 (1j6u A:0-88)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 576986Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 576987Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family) (S)
  5. 576988Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 576989Protein UDP-N-acetylmuramate-alanine ligase MurC [82315] (2 species)
  7. 576999Species Thermotoga maritima [TaxId:243274] [82316] (1 PDB entry)
    TM0231
  8. 577000Domain d1j6ua1: 1j6u A:0-88 [77094]
    Other proteins in same PDB: d1j6ua2, d1j6ua3
    structural genomics
    CASP5
    complexed with mse

Details for d1j6ua1

PDB Entry: 1j6u (more details), 2.3 Å

PDB Description: crystal structure of udp-n-acetylmuramate-alanine ligase murc (tm0231) from thermotoga maritima at 2.3 a resolution

SCOP Domain Sequences for d1j6ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima}
hmkihfvgiggigmsavalhefsngndvygsnieetertaylrklgipifvphsadnwyd
pdlviktpavrddnpeivrarmervpien

SCOP Domain Coordinates for d1j6ua1:

Click to download the PDB-style file with coordinates for d1j6ua1.
(The format of our PDB-style files is described here.)

Timeline for d1j6ua1: