Lineage for d1j6qa_ (1j6q A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2061084Superfamily b.40.9: Heme chaperone CcmE [82093] (1 family) (S)
    automatically mapped to Pfam PF03100
  5. 2061085Family b.40.9.1: Heme chaperone CcmE [82094] (1 protein)
  6. 2061086Protein Heme chaperone CcmE [82095] (2 species)
  7. 2061090Species Shewanella putrefaciens [TaxId:24] [82097] (2 PDB entries)
  8. 2061091Domain d1j6qa_: 1j6q A: [77091]

Details for d1j6qa_

PDB Entry: 1j6q (more details)

PDB Description: solution structure and characterization of the heme chaperone ccme
PDB Compounds: (A:) cytochrome c maturation protein E

SCOPe Domain Sequences for d1j6qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6qa_ b.40.9.1 (A:) Heme chaperone CcmE {Shewanella putrefaciens [TaxId: 24]}
snlnlfytpseivngktdtgvkpeagqrirvggmvtvgsmvrdpnslhvqfavhdslgge
ilvtyddllpdlfregqgivaqgvlgedgklaatevlakh

SCOPe Domain Coordinates for d1j6qa_:

Click to download the PDB-style file with coordinates for d1j6qa_.
(The format of our PDB-style files is described here.)

Timeline for d1j6qa_: