SCOPe 2.03: Domain d1j6oa_: 1j6o A:

Lineage for d1j6oa_ (1j6o A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (4 proteins)
   automatically mapped to Pfam PF01026

6. Protein Hypothetical protein TM0667 [82268] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [82269] (1 PDB entry)

8. Domain d1j6oa_: 1j6o A: [77088]
   complexed with ipa

Details for d1j6oa_

PDB Entry: 1j6o, 1.8 Å

PDB Description: crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution

PDB Compounds: (A:) TatD-related deoxyribonuclease

SCOPe Domain Sequences for d1j6oa_:

Sequence; same for both SEQRES and ATOM records:

>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]}
hhhhmvdthahlhfhqfdddrnavissfeenniefvvnvgvnledskksldlsktsdrif
csvgvhphdakevpedfiehlekfakdekvvaigetgldffrnispaevqkrvfveqiel
agklnlplvvhirdayseayeilrteslpekrgvihafssdyewakkfidlgfllgiggp
vtypknealrevvkrvgleyivletdcpflppqpfrgkrnepkylkyvvetisqvlgvpe
akvdeattenarriflevke

Timeline for d1j6oa_:

• d1j6oa_ first appeared in SCOP 1.63
  
• d1j6oa_ appears in SCOPe 2.02
  
• d1j6oa_ appears in SCOPe 2.04
  
• d1j6oa_ appears in the current release, SCOPe 2.08, called d1j6oa1