![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (4 proteins) |
![]() | Protein Hypothetical protein TM0667 [82268] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [82269] (1 PDB entry) |
![]() | Domain d1j6oa_: 1j6o A: [77088] complexed with ipa |
PDB Entry: 1j6o (more details), 1.8 Å
SCOPe Domain Sequences for d1j6oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} hhhhmvdthahlhfhqfdddrnavissfeenniefvvnvgvnledskksldlsktsdrif csvgvhphdakevpedfiehlekfakdekvvaigetgldffrnispaevqkrvfveqiel agklnlplvvhirdayseayeilrteslpekrgvihafssdyewakkfidlgfllgiggp vtypknealrevvkrvgleyivletdcpflppqpfrgkrnepkylkyvvetisqvlgvpe akvdeattenarriflevke
Timeline for d1j6oa_: