SCOP 1.63: Domain d1j5qb2: 1j5q B:222-437

Lineage for d1j5qb2 (1j5q B:222-437)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll

4. Superfamily b.13.2: Viral proteins [49749] (3 families)
   duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits, form ring structures of six rather than five domains

5. Family b.13.2.3: Major capsid protein vp54 [82013] (1 protein)

6. Protein Major capsid protein vp54 [82014] (1 species)

7. Species Paramecium bursaria chorella virus type 1, PBCV-1 [82015] (2 PDB entries)
   a large, lipid-containing, DNA virus

8. Domain d1j5qb2: 1j5q B:222-437 [77087]
   complexed with hg, man, nag

Details for d1j5qb2

PDB Entry: 1j5q, 2.55 Å

PDB Description: the structure and evolution of the major capsid protein of a large, lipid-containing, dna virus.

SCOP Domain Sequences for d1j5qb2:

Sequence; same for both SEQRES and ATOM records:

>d1j5qb2 b.13.2.3 (B:222-437) Major capsid protein vp54 {Paramecium bursaria chorella virus type 1, PBCV-1}
lpheylieqlqftgsetatpsattqasqnirlnfnhptkylawnfnnptnygqytalani
pgacsgagtaaatvttpdygntgtyneqlavldsakiqlngqdrfatrkgsyfnkvqpyq
siggvtpagvylysfalkpagrqpsgtcnfsridnatlsltyktcsidatspaavlgnte
tvtantatlltalniyaknynvlrimsgmgglayan

Timeline for d1j5qb2:

• d1j5qb2 is new in SCOP 1.63
  
• d1j5qb2 appears in SCOP 1.65
  
• d1j5qb2 last appears in SCOPe 2.06