Lineage for d1j5na_ (1j5n A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211587Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 211588Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 211589Family a.21.1.1: HMG-box [47096] (9 proteins)
  6. 211610Protein NHP6a [47102] (1 species)
  7. 211611Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47103] (3 PDB entries)
  8. 211613Domain d1j5na_: 1j5n A: [77083]

Details for d1j5na_

PDB Entry: 1j5n (more details)

PDB Description: solution structure of the non-sequence-specific hmgb protein nhp6a in complex with sry dna

SCOP Domain Sequences for d1j5na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5na_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae)}
mvtprepkkrttrkkkdpnapkralsaymffanenrdivrsenpditfgqvgkklgekwk
altpeekqpyeakaqadkkryesekelynatla

SCOP Domain Coordinates for d1j5na_:

Click to download the PDB-style file with coordinates for d1j5na_.
(The format of our PDB-style files is described here.)

Timeline for d1j5na_: