Lineage for d1j3ba1 (1j3b A:212-529)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 250436Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 250437Superfamily c.91.1: PEP carboxykinase-like [53795] (2 families) (S)
  5. 250438Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (2 proteins)
  6. 250445Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) [68921] (3 species)
  7. 250452Species Thermus thermophilus [TaxId:274] [82553] (1 PDB entry)
  8. 250453Domain d1j3ba1: 1j3b A:212-529 [77071]
    Other proteins in same PDB: d1j3ba2, d1j3bb2

Details for d1j3ba1

PDB Entry: 1j3b (more details), 2 Å

PDB Description: Crystal structure of ATP-dependent phosphoenolpyruvate carboxykinase from Thermus thermophilus HB8

SCOP Domain Sequences for d1j3ba1:

Sequence, based on SEQRES records: (download)

>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) {Thermus thermophilus}
vfpmhasanvgkegdvavffglsgtgkttlstdperpligddehgwsedgvfnfeggcya
kvirlspehepliykasnqfeailenvvvnpesrrvqwdddsktentrssypiahlenvv
esgvaghpraifflsadaygvlppiarlspeeamyyflsgytarvagtergvtepratfs
acfgapflpmhpgvyarmlgekirkhaprvylvntgwtggpygvgyrfplpvtrallkaa
lsgalenvpyrrdpvfgfevpleapgvpqellnpretwadkeaydqqarklarlfqenfq
kyasgvakevaeagprte

Sequence, based on observed residues (ATOM records): (download)

>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) {Thermus thermophilus}
vfpmhasanvgkegdvavffglsgtgkttlstdperpligddehgwsedgvfnfeggcya
kvirlspehepliykasnqfeailenvvvnpesrrvqwdddsktentrssypiahlenvv
esgvaghpraifflsadaygvlppiarlspeeamyyflsgytarvpratfsacfgapflp
mhpgvyarmlgekirkhaprvylvntgwtggpygvgyrfplpvtrallkaalsgalenvp
yrrdpvfgfevpleapgvpqellnpretwadkeaydqqarklarlfqenfqkyasgvake
vaeagprte

SCOP Domain Coordinates for d1j3ba1:

Click to download the PDB-style file with coordinates for d1j3ba1.
(The format of our PDB-style files is described here.)

Timeline for d1j3ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j3ba2