Lineage for d1j3aa_ (1j3a A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837505Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 1837506Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 1837507Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 1837508Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 1837587Species Pyrococcus horikoshii [TaxId:53953] [82339] (1 PDB entry)
  8. 1837588Domain d1j3aa_: 1j3a A: [77070]

Details for d1j3aa_

PDB Entry: 1j3a (more details), 1.6 Å

PDB Description: Crystal structure of ribosomal protein L13 from Pyrococcus horikoshii
PDB Compounds: (A:) 50S ribosomal protein L13P

SCOPe Domain Sequences for d1j3aa_:

Sequence, based on SEQRES records: (download)

>d1j3aa_ c.21.1.1 (A:) Ribosomal protein L13 {Pyrococcus horikoshii [TaxId: 53953]}
mriinadglilgrlasrvakmllegeevvivnaekavitgnrevifskykqrtglrtltn
prrgpfypkrsdeivrrtirgmlpwktdrgrkafrrlkvyvgipkefqdkqletiveahv
srlsrpkyvtvgevakflggkf

Sequence, based on observed residues (ATOM records): (download)

>d1j3aa_ c.21.1.1 (A:) Ribosomal protein L13 {Pyrococcus horikoshii [TaxId: 53953]}
mriinadglilgrlasrvakmllegeevvivnaekavitgnrevifskykqrtypkrsde
ivrrtirgmlpwktdrgrkafrrlkvyvgipkefqdkqletiveahvsrlsrpkyvtvge
vakflggkf

SCOPe Domain Coordinates for d1j3aa_:

Click to download the PDB-style file with coordinates for d1j3aa_.
(The format of our PDB-style files is described here.)

Timeline for d1j3aa_: