Lineage for d1j33a_ (1j33 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114880Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567
  4. 2114881Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (2 families) (S)
  5. 2114882Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (2 protein domains)
    automatically mapped to Pfam PF02277
  6. 2114883Protein Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52735] (2 species)
  7. 2114913Species Thermus thermophilus [TaxId:274] [82423] (1 PDB entry)
  8. 2114914Domain d1j33a_: 1j33 A: [77069]

Details for d1j33a_

PDB Entry: 1j33 (more details), 2 Å

PDB Description: Crystal structure of CobT from Thermus thermophilus HB8
PDB Compounds: (A:) CobT

SCOPe Domain Sequences for d1j33a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j33a_ c.39.1.1 (A:) Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) {Thermus thermophilus [TaxId: 274]}
pevfaqarlrmdqltkppralgyleevalrlaalqgrvkpelgrgavvvaaadhgvvaeg
vsaypqevtrqmvlnflrggaainqfalaadcavyvldvgvvgelpdhpgllkrkvrpgt
anlaqgpamtpeeaerallagreaarraiaegatllaagdmgignttaaaaltaallglp
peavvgrgtgvgeeglrrkrqavaralarlhpgmgplevaaevggielvaiagiylegye
aglplvldgfpvtagallawkmapglrdhlfaghlsrepghrhqlealglrplldldlal
gegtgavlampllraaarilhmatfqeagvsrg

SCOPe Domain Coordinates for d1j33a_:

Click to download the PDB-style file with coordinates for d1j33a_.
(The format of our PDB-style files is described here.)

Timeline for d1j33a_: