Lineage for d1j1xl_ (1j1x L:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 288075Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)
  8. 288084Domain d1j1xl_: 1j1x L: [77064]
    Other proteins in same PDB: d1j1xh_, d1j1xy_
    part of Fv HyHEL-10
    mutant

Details for d1j1xl_

PDB Entry: 1j1x (more details), 1.8 Å

PDB Description: Crystal Structure of HyHEL-10 Fv mutant LS93A complexed with hen egg white lysozyme
PDB Compounds: (L:)

SCOP Domain Sequences for d1j1xl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnawpytfgggtkleik

SCOP Domain Coordinates for d1j1xl_:

Click to download the PDB-style file with coordinates for d1j1xl_.
(The format of our PDB-style files is described here.)

Timeline for d1j1xl_: