Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (31 PDB entries) |
Domain d1j1xh_: 1j1x H: [77063] Other proteins in same PDB: d1j1xl_, d1j1xy_ part of Fv HyHEL-10 mutant |
PDB Entry: 1j1x (more details), 1.8 Å
SCOPe Domain Sequences for d1j1xh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j1xh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]} dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa
Timeline for d1j1xh_: