SCOP 1.71: Domain d1j1xh_: 1j1x H:

Lineage for d1j1xh_ (1j1x H:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (20 PDB entries)

8. Domain d1j1xh_: 1j1x H: [77063]
   Other proteins in same PDB: d1j1xl_, d1j1xy_
   part of Fv HyHEL-10
   mutant

Details for d1j1xh_

PDB Entry: 1j1x, 1.8 Å

PDB Description: crystal structure of hyhel-10 fv mutant ls93a complexed with hen egg white lysozyme

SCOP Domain Sequences for d1j1xh_:

Sequence; same for both SEQRES and ATOM records:

>d1j1xh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

Timeline for d1j1xh_:

• d1j1xh_ first appeared in SCOP 1.63
  
• d1j1xh_ appears in SCOP 1.69
  
• d1j1xh_ appears in SCOP 1.73
  
• d1j1xh_ appears in the current release, SCOPe 2.08